Danish

Uniprot ID: Q5VTY9

Protein: Protein-cysteine N-palmitoyltransferase HHAT
Organism: Human (Homo sapiens)
Length: 493
Sequence:

MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLHTTISFCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYYTSFSLELCWQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKASLCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKYLVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPVGGSQHGLLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFSPQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYSHVGIAWAQTYATD

Number of chains: 5

PDB ID: 7mhy , Chain A
Residue indices (Uniprot), coverage	1-491 (1-493), 1.00
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 7mhz , Chain B
Residue indices (Uniprot), coverage	1-491 (1-493), 1.00
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 7q1u , Chain A
Residue indices (Uniprot), coverage	1-493 (1-493), 1.00
Difference from Uniprot sequence	expression tag:variant
auth_asym_id	A
Structural gaps	Exists
Nonstandard amino acids	P1L
label_asym_ids of heme	D
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 7q6z , Chain A
Residue indices (Uniprot), coverage	1-493 (1-493), 1.00
Difference from Uniprot sequence	conflict:expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	D
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 7urf , Chain A
Residue indices (Uniprot), coverage	1-491 (1-493), 1.00
Difference from Uniprot sequence	conflict:expression tag
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB