Danish
Uniprot ID:  Q5VTY9
  • Protein: Protein-cysteine N-palmitoyltransferase HHAT
  • Organism: Human (Homo sapiens)
  • Length: 493
  • Sequence:
    • MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEWSFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLHTTISFCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYYTSFSLELCWQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKASLCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKYLVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPVGGSQHGLLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFSPQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYSHVGIAWAQTYATD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00007q1u , Chain A 
Residue indices (Uniprot), coverage 1-493 (1-493), 1.00
Difference from Uniprot sequence expression tag:variant
Mutations (UniProt numbering) S182N
Insertions 493insGTETSQVAPA
Deletions None
Sequence identity to UniProt 0.9980
auth_asym_id A
Missing residues 189TRP-196SER:387CYS-387CYS
Structural gaps Exists
Nonstandard amino acids P1L Structure of P1LP1L
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00007q6z , Chain A 
Residue indices (Uniprot), coverage 1-493 (1-493), 1.00
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) S182N
Insertions 493insGTETSQVAPA
Deletions None
Sequence identity to UniProt 0.9980
auth_asym_id A
Missing residues 189TRP-196SER
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007urf , Chain A 
Residue indices (Uniprot), coverage 1-491 (1-493), 1.00
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) H379C
Insertions 493insDYKDDDK
Deletions None
Sequence identity to UniProt 0.9980
auth_asym_id A
label_asym_ids of heme E
Available structure PDB