Danish
Uniprot ID:  Q74FJ0
  • Protein: Cytochrome c
  • Organism: Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
  • Length: 232
  • Sequence:
    • MRSEVKIGLALTALLVAVTAAGAASIKNTKHDLSSGSTGATFKATNTDQICVFCHTPHNAQQDIPLWNRGNPTASTFTLYSSSSMNNVPVKQGFTADSISLFCMSCHDGATGLGGAVHNDPNGAAIAMVGGNDLITGEANLGTDLSNDHPVNFEVTPAGIAADGNLGALDTGTNPPTMKTGDVTNGLPLFKSARGATTLECGSCHKVHDNTDAPFLRTTMAGSKLCLGCHKK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  7
PDB ID:  pdb_00007tfs , Chain A 
Residue indices (Uniprot), coverage 30-231 (1-232), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D-1 ,  E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00007tfs , Chain A-1 
Residue indices (Uniprot), coverage 30-231 (1-232), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D-2 ,  E-1 ,  D-1 ,  C-1 ,  B-1
Available structure PDB
PDB ID:  pdb_00007tfs , Chain A-2 
Residue indices (Uniprot), coverage 30-231 (1-232), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D-3 ,  E-2 ,  D-2 ,  C-2 ,  B-2
Available structure PDB
PDB ID:  pdb_00007tfs , Chain A-3 
Residue indices (Uniprot), coverage 30-231 (1-232), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D-4 ,  E-3 ,  D-3 ,  C-3 ,  B-3
Available structure PDB
PDB ID:  pdb_00007tfs , Chain A-4 
Residue indices (Uniprot), coverage 30-231 (1-232), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D-5 ,  E-4 ,  D-4 ,  C-4 ,  B-4
Available structure PDB
PDB ID:  pdb_00007tfs , Chain A-5 
Residue indices (Uniprot), coverage 30-231 (1-232), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D-6 ,  E-5 ,  D-5 ,  C-5 ,  B-5
Available structure PDB
PDB ID:  pdb_00007tfs , Chain A-6 
Residue indices (Uniprot), coverage 30-231 (1-232), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E-6 ,  D-6 ,  C-6 ,  B-6
Available structure PDB