- Protein: Cytochrome c
- Organism:
- Length: 232
- Sequence:
MRSEVKIGLALTALLVAVTAAGAASIKNTKHDLSSGSTGATFKATNTDQICVFCHTPHNAQQDIPLWNRGNPTASTFTLYSSSSMNNVPVKQGFTADSISLFCMSCHDGATGLGGAVHNDPNGAAIAMVGGNDLITGEANLGTDLSNDHPVNFEVTPAGIAADGNLGALDTGTNPPTMKTGDVTNGLPLFKSARGATTLECGSCHKVHDNTDAPFLRTTMAGSKLCLGCHKK
| Residue indices (Uniprot), coverage | 30-231 (1-232), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B , C , D , E , D-1 |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 30-231 (1-232), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B-1 , C-1 , D-1 , E-1 , D-2 |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 30-231 (1-232), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B-2 , C-2 , D-2 , E-2 , D-3 |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 30-231 (1-232), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B-3 , C-3 , D-3 , E-3 , D-4 |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 30-231 (1-232), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B-4 , C-4 , D-4 , E-4 , D-5 |
| Available structure | PDB |