Danish

Uniprot ID: Q7SID0

Protein: Globin-F1
Organism: Inshore hagfish (Eptatretus burgeri)
Length: 146
Sequence:

PIIDQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTIDGGAEFEKLFSIICILLRSAY

Number of chains: 6

PDB ID: 1it2 , Chain A
Resolution	1.60 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1it2 , Chain B
Resolution	1.60 Å
Residue indices (Uniprot), coverage	201-346 (1-146), 1.00
auth_asym_id	B
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1it3 , Chain A
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-146 (1-146), 1.00
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1it3 , Chain B
Resolution	2.10 Å
Residue indices (Uniprot), coverage	201-346 (1-146), 1.00
auth_asym_id	B
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 1it3 , Chain C
Resolution	2.10 Å
Residue indices (Uniprot), coverage	401-546 (1-146), 1.00
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 1it3 , Chain D
Resolution	2.10 Å
Residue indices (Uniprot), coverage	601-746 (1-146), 1.00
auth_asym_id	D
label_asym_ids of heme	K
Available structure	PDB