- Protein: Cytochrome P460 domain-containing protein
- Organism:
- Length: 174
- Sequence:
MKSSFGLSALVGLTLSLHAYAGGNPEFVKFPEKYEQIFTHYDTANRANQTQLAKFYANEIAAESYKKGEEAAPGSIVIMEIYAPKKDAEGKIQSGEDGLFVIDKLAAIAVMEKRNDWGSAFKADDRSGNWGFALYDPEGKAKDNDLTCAQCHNPLQKQDNLFSFQKLVDYVKAH
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-176 (22-174), 0.88 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-176 (22-174), 0.88 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | B |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-180 (22-174), 0.88 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | C |
| label_asym_ids of heme | K |
| Available structure | PDB |