Danish
Uniprot ID:  Q8E4J9
  • Protein: HTH marR-type domain-containing protein
  • Organism: Streptococcus agalactiae serotype III (strain NEM316)
  • Length: 146
  • Sequence:
    • MENPLQKARILVNQLEKYLDRYAKEYDVEHLAGPQGHLVMHLYKHPDKDMSIKDAEEILHISKSVASNLVKRMEKNGFIAIVPSKTDKRVKYLYLTHLGKQKATQFEIFLEKLHSTMLAGITKEEIRTTKKVIRTLAKNMAMEDFD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00007dvr , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-147 (1-146), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 146insSLEVLFQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B-1 ,  B
Available structure PDB
PDB ID:  pdb_00007dvr , Chain A-1 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-147 (1-146), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 146insSLEVLFQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B-1 ,  B
Available structure PDB
PDB ID:  pdb_00007dvt , Chain A 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 3-148 (1-146), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 146insSLEVLFQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007dvt , Chain A-1 
Resolution 2.09 Å
Residue indices (Uniprot), coverage 3-148 (1-146), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 146insSLEVLFQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00007dvu , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-142 (1-146), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 146insSLEVLFQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007dvu , Chain A-1 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-142 (1-146), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 146insSLEVLFQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB