Danish

Uniprot ID: Q8E4J9

Protein: HTH marR-type domain-containing protein
Organism:
Length: 146
Sequence:

MENPLQKARILVNQLEKYLDRYAKEYDVEHLAGPQGHLVMHLYKHPDKDMSIKDAEEILHISKSVASNLVKRMEKNGFIAIVPSKTDKRVKYLYLTHLGKQKATQFEIFLEKLHSTMLAGITKEEIRTTKKVIRTLAKNMAMEDFD

Number of chains: 6

PDB ID: 7dvr , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-147 (1-146), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
label_asym_ids of heme	B , B-1
Available structure	PDB

PDB ID: 7dvr , Chain A-1
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-147 (1-146), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
label_asym_ids of heme	B , B-1
Available structure	PDB

PDB ID: 7dvt , Chain A
Resolution	2.09 Å
Residue indices (Uniprot), coverage	3-148 (1-146), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 7dvt , Chain A-1
Resolution	2.09 Å
Residue indices (Uniprot), coverage	3-148 (1-146), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
label_asym_ids of heme	B-1
Available structure	PDB

PDB ID: 7dvu , Chain A
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-142 (1-146), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 7dvu , Chain A-1
Resolution	2.10 Å
Residue indices (Uniprot), coverage	1-142 (1-146), 1.00
Difference from Uniprot sequence	expression tag
auth_asym_id	A
label_asym_ids of heme	B-1
Available structure	PDB