- Protein: Cytochrome c, putative
- Organism:
- Length: 159
- Sequence:
MNIGGYKKKGNLDDEFPDDFVLPPGDKVKGEKLFKKHCKQCHSIAPDNSQTNSGFTSWGPTLFNVYNRTAGMSKGNSPFQTSPDLYTSGIIWNDVNLLKYMKNPQQFVESHIGMNFKGLSNLQERVDIVHYLKTLTYDDPYGKQIVEKYTKKGKTSGSK
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 20-150 (1-159), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 20-150 (1-159), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 20-148 (1-159), 1.00 |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.13 Å |
| Resolution | 2.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 20-151 (1-159), 1.00 |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | D |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.15 Å |