- Protein: Cytochrome bc1 complex cytochrome c subunit
- Organism:
- Length: 283
- Sequence:
MAKPSAKKVKNRRKVRRTVAGALALTIGLSGAGILATAITPDAQVATAQRDDQALISEGKDLYDVACITCHGVNLQGVEDRGPSLVGVGEGAVYFQVHSGRMPILRNEAQAERKAPRYTEAQTLAIAAYVAANGGGPGLVYNEDGTLAMEELRGENYDGQITSADVARGGDLFRLNCASCHNFTGRGGALSSGKYAPNLDAANEQEIYQAMLTGPQNMPKFSDRQLSADEKKDIIAFIKSTKETPSPGGYSLGSLGPVAEGLFMWVFGILVLVAAAMWIGSRS
| Resolution | 3.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 52-283 (1-283), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | RB , SB |
| Available structure | PDB |
| Resolution | 3.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 52-283 (1-283), 1.00 |
| auth_asym_id | c |
| label_asym_ids of heme | JD , KD |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 51-283 (1-283), 1.00 |
|---|---|
| auth_asym_id | C |
| label_asym_ids of heme | OA , PA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 51-283 (1-283), 1.00 |
|---|---|
| auth_asym_id | P |
| label_asym_ids of heme | DC , EC |
| Available structure | PDB |