Danish

Uniprot ID: Q939U1

Protein: L-cysteine S-thiosulfotransferase subunit SoxA
Organism: Rhodobacter sulfidophilus (Rhodovulum sulfidophilum)
Length: 287
Sequence:

MKTMTGRLVAAALVCGGAFSGAAVSAGPDDPLVINGEIEIVTRAPTPAHLADRFDEIRSGWTFRTDDTQALEMDDFENSGMVFVEEARAVWDRPEGTEGKACADCHGAVDDGMYGLRAVYPKYVESAGKVRTVEQMINACRTSRMGAPEWDYIGPDMTAMVALIASVSRGMPVSVAIDGPAQSTWEKGREIYYTRYGQLDLSCASCHEQYFDHYIRADHLSQGQINGFPSYRLKNARLNAVHDRFRGCIRDTRGVPFAVGSPEFVALELYVASRGNGLSVEGPSVRN

Number of chains: 10

PDB ID: 1h32 , Chain A
Resolution	1.50 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
auth_asym_id	A
Nonstandard amino acids	CSS
label_asym_ids of heme	D , E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 1h33 , Chain A
Resolution	1.75 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
auth_asym_id	A
Nonstandard amino acids	CSS
label_asym_ids of heme	C , D
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.09 Å

PDB ID: 2oz1 , Chain A
Resolution	2.35 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
Difference from Uniprot sequence	modified residue
auth_asym_id	A
Nonstandard amino acids	CSS
label_asym_ids of heme	I , J
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 2oz1 , Chain C
Resolution	2.35 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
Difference from Uniprot sequence	modified residue
auth_asym_id	C
Nonstandard amino acids	CSS
label_asym_ids of heme	L , M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 2oz1 , Chain E
Resolution	2.35 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
Difference from Uniprot sequence	modified residue
auth_asym_id	E
Nonstandard amino acids	CSS
label_asym_ids of heme	O , P
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 2oz1 , Chain G
Resolution	2.35 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
Difference from Uniprot sequence	modified residue
auth_asym_id	G
Nonstandard amino acids	CSS
label_asym_ids of heme	R , S
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.09 Å

PDB ID: 1h31 , Chain A
Resolution	2.55 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
auth_asym_id	A
Nonstandard amino acids	CSS
label_asym_ids of heme	I , J
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 1h31 , Chain C
Resolution	2.55 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
auth_asym_id	C
Nonstandard amino acids	CSS
label_asym_ids of heme	L , M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 1h31 , Chain E
Resolution	2.55 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
auth_asym_id	E
Nonstandard amino acids	CSS
label_asym_ids of heme	O , P
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 1h31 , Chain G
Resolution	2.55 Å
Residue indices (Uniprot), coverage	1-261 (27-287), 0.91
auth_asym_id	G
Nonstandard amino acids	CSS
label_asym_ids of heme	R , S
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å