- Protein: Cytochrome c
- Organism: Rhodobacter sulfidophilus (Rhodovulum sulfidophilum)
- Length: 160
- Sequence:
MRGMGLTTACIALWASAGPGPAAEVAPGDVAIDGQGHVARPLTDAPGDPVEGRRLMTDRSVGNCIACHEVTEMADAQFPGTVGPSLDGVAARYPEAMIRGILVNSKNVFPETVMPAYYRVEGFNRPGIAFTSKPIEGEIRPLMTAGQIEDVVAYLMTLTQ
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (23-160), 0.86 |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | G |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Resolution | 1.75 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (23-160), 0.86 |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | E |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.12 Å |
| Resolution | 2.35 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (23-160), 0.86 |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | K |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |
| Resolution | 2.35 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (23-160), 0.86 |
| auth_asym_id | D |
| label_asym_ids of heme | N |
| Available structure | PDB |
| Resolution | 2.35 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-138 (23-160), 0.86 |
| auth_asym_id | F |
| label_asym_ids of heme | Q |
| Available structure | PDB |
| Resolution | 2.35 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-138 (23-160), 0.86 |
| auth_asym_id | H |
| label_asym_ids of heme | T |
| Available structure | PDB |
| Resolution | 2.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-138 (23-160), 0.86 |
| auth_asym_id | B |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 2.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-138 (23-160), 0.86 |
| auth_asym_id | D |
| label_asym_ids of heme | N |
| Available structure | PDB |
| Resolution | 2.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-138 (23-160), 0.86 |
| auth_asym_id | F |
| label_asym_ids of heme | Q |
| Available structure | PDB |
| Resolution | 2.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-138 (23-160), 0.86 |
| auth_asym_id | H |
| label_asym_ids of heme | T |
| Available structure | PDB |