Danish

Uniprot ID: Q9D0M3

Protein: Cytochrome c1, heme protein, mitochondrial
Organism: Mouse (Mus musculus)
Length: 325
Sequence:

MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAVSLSSKSGPSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPPK

Number of chains: 14

PDB ID: 7o37 , Chain D
Residue indices (Uniprot), coverage	1-241 (85-325), 0.74
auth_asym_id	D
label_asym_ids of heme	PA
Available structure	PDB

PDB ID: 7o37 , Chain N
Residue indices (Uniprot), coverage	1-240 (85-325), 0.74
auth_asym_id	O
label_asym_ids of heme	FB
Available structure	PDB

PDB ID: 7o3c , Chain D
Residue indices (Uniprot), coverage	1-241 (85-325), 0.74
auth_asym_id	D
label_asym_ids of heme	PA
Available structure	PDB

PDB ID: 7o3c , Chain N
Residue indices (Uniprot), coverage	1-240 (85-325), 0.74
auth_asym_id	O
label_asym_ids of heme	CB
Available structure	PDB

PDB ID: 7o3e , Chain D
Residue indices (Uniprot), coverage	1-241 (85-325), 0.74
auth_asym_id	D
label_asym_ids of heme	KA
Available structure	PDB

PDB ID: 7o3e , Chain EA
Residue indices (Uniprot), coverage	1-240 (85-325), 0.74
auth_asym_id	O
label_asym_ids of heme	MB
Available structure	PDB

PDB ID: 7o3h , Chain D
Residue indices (Uniprot), coverage	1-241 (85-325), 0.74
auth_asym_id	D
label_asym_ids of heme	AA
Available structure	PDB

PDB ID: 7o3h , Chain N
Residue indices (Uniprot), coverage	1-240 (85-325), 0.74
auth_asym_id	O
label_asym_ids of heme	OA
Available structure	PDB

PDB ID: 8pw5 , Chain D
Residue indices (Uniprot), coverage	1-240 (1-325), 1.00
auth_asym_id	D
label_asym_ids of heme	UC
Available structure	PDB

PDB ID: 8pw5 , Chain N
Residue indices (Uniprot), coverage	1-240 (1-325), 1.00
auth_asym_id	O
label_asym_ids of heme	LD
Available structure	PDB

PDB ID: 8pw6 , Chain D
Residue indices (Uniprot), coverage	1-240 (1-325), 1.00
auth_asym_id	D
label_asym_ids of heme	JC
Available structure	PDB

PDB ID: 8pw6 , Chain N
Residue indices (Uniprot), coverage	1-240 (1-325), 1.00
auth_asym_id	O
label_asym_ids of heme	VC
Available structure	PDB

PDB ID: 8pw7 , Chain AA
Residue indices (Uniprot), coverage	1-240 (1-325), 1.00
auth_asym_id	O
label_asym_ids of heme	ND
Available structure	PDB

PDB ID: 8pw7 , Chain Q
Residue indices (Uniprot), coverage	1-240 (1-325), 1.00
auth_asym_id	D
label_asym_ids of heme	XC
Available structure	PDB