Danish

Uniprot ID: Q9L915

Protein: Class III cytochrome C family protein
Organism:
Length: 128
Sequence:

MKKTLALTCMLALLLAVSAWAAPAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSGCHDDLTAKKGEKSLYYVVHAKGELKHTSCLACHSKVVAEKPELKKDLTGCAKSKCHP

Number of chains: 6

PDB ID: 1up9 , Chain A
Resolution	1.35 Å
Residue indices (Uniprot), coverage	1-107 (22-128), 0.84
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 1upd , Chain A
Resolution	1.40 Å
Residue indices (Uniprot), coverage	1-107 (22-128), 0.84
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 3cyr , Chain A
Resolution	1.60 Å
Residue indices (Uniprot), coverage	1-107 (22-128), 0.84
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 1i77 , Chain A
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-107 (22-128), 0.84
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 1gmb , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-107 (22-128), 0.84
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB

PDB ID: 1gm4 , Chain A
Resolution	2.05 Å
Residue indices (Uniprot), coverage	1-107 (22-128), 0.84
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B , C , D , E
Available structure	PDB