Danish
Uniprot ID:  Q9L915
  • Protein: Class III cytochrome C family protein
  • Organism: Desulfovibrio desulfuricans
  • Length: 128
  • Sequence:
    • MKKTLALTCMLALLLAVSAWAAPAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSGCHDDLTAKKGEKSLYYVVHAKGELKHTSCLACHSKVVAEKPELKKDLTGCAKSKCHP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00001up9 , Chain A 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-107 (22-128), 0.84
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K92R
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00001upd , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 1-107 (22-128), 0.84
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K92R
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00003cyr , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-107 (22-128), 0.84
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D27N
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00001i77 , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 1-107 (22-128), 0.84
Mutations (UniProt numbering) V25A, V30L, V32F, P45V, E47A, L57Q, Y64F, T77A, A78G, K80Q, A91T, G93K, S99N, L101I, A102G, A109E, E110G, G120A
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.8318
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00001gmb , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-107 (22-128), 0.84
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K92R
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00001gm4 , Chain A 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 1-107 (22-128), 0.84
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K92R
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB