- Protein: Dehaloperoxidase B
- Organism:
- Length: 138
- Sequence:
MGFKQDIATLRGDLRTYAQDIFLAFLNKYPDEKRNFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDASTLVQMKQHSGLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK
| Resolution | 1.08 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.08 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.08 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.08 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.12 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.12 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.14 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.14 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 1.35 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.35 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 1.37 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.37 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | M |
| Available structure | PDB |
| Resolution | 1.42 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.42 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.45 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (1-138), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.45 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (1-138), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.48 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.48 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.48 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.48 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.49 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.49 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 1.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.55 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.57 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | AAA |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.57 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | BBB |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.57 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.57 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.58 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C , C |
| Available structure | PDB |
| Resolution | 1.58 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I , I |
| Available structure | PDB |
| Resolution | 1.58 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C , C |
| Available structure | PDB |
| Resolution | 1.58 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I , I |
| Available structure | PDB |
| Resolution | 1.58 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.58 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | M |
| Available structure | PDB |
| Resolution | 1.65 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.65 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | L |
| Available structure | PDB |
| Resolution | 1.66 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.66 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.66 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.66 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 1.69 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.69 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | O |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 1.72 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.72 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.72 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.72 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.73 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.73 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | L |
| Available structure | PDB |
| Resolution | 1.75 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.75 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.75 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.75 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.76 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.76 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | M |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | N |
| Available structure | PDB |
| Resolution | 1.81 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.81 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | L |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (1-138), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (1-138), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (1-138), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (1-138), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.87 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.87 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.87 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.87 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.91 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.91 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.93 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | P |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.96 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.96 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.96 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.96 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.98 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.98 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 2.01 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (1-138), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.01 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (1-138), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.05 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.05 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.22 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.22 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-137 (2-138), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |