- Protein: Neuroglobin
- Organism: Human (Homo sapiens)
- Length: 151
- Sequence:
MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
| Resolution | 1.35 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-148 (2-149), 0.98 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.74 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-149 (1-151), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.74 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-149 (1-151), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-149 (1-151), 1.00 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-151 (1-151), 1.00 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-151 (1-151), 1.00 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | C |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-150 (1-151), 1.00 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | D |
| label_asym_ids of heme | O |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 3-149 (1-151), 1.00 |
|---|---|
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |