Danish

Uniprot ID: Q9RQB9

Protein: Cytochrome c''
Organism: Bacterium W3A1 (Methylophilus methylotrophus)
Length: 144
Sequence:

MKIKTIIAVFGVLFSAHALADVTNAEKLVYKYTNIAHSANPMYEAPSITDGKIFFNRKFKTPSGKEAACASCHTNNPANVGKNIVTGKEIPPLAPRVNTKRFTDIDKVEDEFTKHCNDILGADCSPSEKANFIAYLLTETKPTK

Number of chains: 5

PDB ID: 1gu2 , Chain A
Resolution	1.19 Å
Residue indices (Uniprot), coverage	1-124 (21-144), 0.86
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1gu2 , Chain B
Resolution	1.19 Å
Residue indices (Uniprot), coverage	1-123 (21-144), 0.86
auth_asym_id	B
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1oae , Chain A
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-124 (21-144), 0.86
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1oae , Chain B
Resolution	1.95 Å
Residue indices (Uniprot), coverage	1-124 (21-144), 0.86
auth_asym_id	B
label_asym_ids of heme	J
Available structure	PDB

PDB ID: 1e8e , Chain A
Residue indices (Uniprot), coverage	1-124 (21-144), 0.86
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB