Danish
Uniprot ID:  Q9UHE8
  • Protein: STEAP1 protein
  • Organism: Human (Homo sapiens)
  • Length: 339
  • Sequence:
    • MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00006y9b , Chain A 
Residue indices (Uniprot), coverage 67-312 (2-339), 1.00
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) None
Insertions 1insGS, 339insAAAGAAWSHPQFEKGAAWSHPQFEKGAAWSHPQFEKGAA
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 146LYS-147TYR
Structural gaps Exists
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00006y9b , Chain H 
Residue indices (Uniprot), coverage 67-312 (2-339), 1.00
Mutations (UniProt numbering) None
Insertions 1insGS, 339insAAAGAAWSHPQFEKGAAWSHPQFEKGAAWSHPQFEKGAA
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 146LYS-147TYR
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00006y9b , Chain I 
Residue indices (Uniprot), coverage 67-312 (2-339), 1.00
Mutations (UniProt numbering) None
Insertions 1insGS, 339insAAAGAAWSHPQFEKGAAWSHPQFEKGAAWSHPQFEKGAA
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 146LYS-147TYR
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00008ucd , Chain A 
Residue indices (Uniprot), coverage 66-310 (1-339), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 339insGGGGSDYKDDDDK
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 144GLY-148LYS
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008ucd , Chain B 
Residue indices (Uniprot), coverage 67-311 (1-339), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 339insGGGGSDYKDDDDK
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 142HIS-149LYS
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00008ucd , Chain C 
Residue indices (Uniprot), coverage 67-310 (1-339), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 339insGGGGSDYKDDDDK
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 143ASN-149LYS
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.08 Å