- Protein: STEAP1 protein
- Organism: Human (Homo sapiens)
- Length: 339
- Sequence:
MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
| Residue indices (Uniprot), coverage | 67-312 (2-339), 1.00 |
|---|---|
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | C |
| Structural gaps | Exists |
| label_asym_ids of heme | J |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.14 Å |
| Residue indices (Uniprot), coverage | 67-312 (2-339), 1.00 |
|---|---|
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | L |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.13 Å |
| Residue indices (Uniprot), coverage | 67-312 (2-339), 1.00 |
|---|---|
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | N |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.14 Å |
| Residue indices (Uniprot), coverage | 66-310 (1-339), 1.00 |
|---|---|
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | I |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.13 Å |
| Residue indices (Uniprot), coverage | 67-311 (1-339), 1.00 |
|---|---|
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | L |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Residue indices (Uniprot), coverage | 67-310 (1-339), 1.00 |
|---|---|
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | C |
| Structural gaps | Exists |
| label_asym_ids of heme | N |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |