Danish
Uniprot ID:  Q9Y6A2
  • Protein: Cholesterol 24-hydroxylase
  • Organism: Human (Homo sapiens)
  • Length: 500
  • Sequence:
    • MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  24
PDB ID:  pdb_00007n6f , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 27-489 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Missing residues 38ARG-56GLY:228THR-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00003mdm , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 57-491 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007n3l , Chain A 
Resolution 1.63 Å
Residue indices (Uniprot), coverage 28-489 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Missing residues 38ARG-56GLY:227ASN-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00009nna , Chain A 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 28-489 (28-494), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007n3m , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 28-491 (28-494), 0.95
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id AAA
Missing residues 38ARG-56GLY:228THR-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00009nni , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 28-491 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Missing residues 38ARG-56GLY:228THR-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00009nnm , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 27-491 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Missing residues 38ARG-56GLY:79VAL-81HIS:226ARG-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00009nno , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 28-491 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Missing residues 38ARG-56GLY:226ARG-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00002q9f , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 59-491 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00009nne , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 28-491 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Missing residues 38ARG-56GLY:228THR-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00007lrl , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 28-491 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Missing residues 38ARG-56GLY:227ASN-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00003mdr , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 58-491 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id A
Missing residues 229LEU-235GLY
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00003mdr , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 58-489 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id B
Missing residues 229LEU-235GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007ls4 , Chain A 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 28-489 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004fia , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 57-489 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id A
Missing residues 229LEU-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00007ls3 , Chain A 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 28-489 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00009nnj , Chain A 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 28-491 (28-494), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F22H, V23H, R25H, A26H, R27H
Insertions None
Deletions S2-T21, P495-C500
Sequence identity to UniProt 0.9895
auth_asym_id A
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003mdt , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 59-489 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id A
Missing residues 229LEU-235GLY
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00003mdt , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 59-489 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id B
Missing residues 229LEU-235GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00002q9g , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 59-490 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id A
Missing residues 230ALA-239GLN
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00003mdv , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 59-489 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id A
Missing residues 229LEU-235GLY
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00003mdv , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 59-489 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id B
Missing residues 229LEU-235GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004enh , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 59-490 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id A
Missing residues 230ALA-235GLY
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004j14 , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 56-491 (51-500), 0.90
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) W50A
Insertions 500insHHHH
Deletions S2-F49
Sequence identity to UniProt 0.9978
auth_asym_id A
label_asym_ids of heme B
Available structure PDB