- Protein: Cholesterol 24-hydroxylase
- Organism: Human (Homo sapiens)
- Length: 500
- Sequence:
MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
| Resolution | 1.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 27-489 (28-494), 0.93 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 57-491 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.63 Å |
|---|---|
| Residue indices (Uniprot), coverage | 28-489 (28-494), 0.93 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 28-491 (28-494), 0.93 |
| auth_asym_id | AAA |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.12 Å |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 59-491 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 28-491 (28-494), 0.93 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 58-491 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 58-489 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | E |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.15 Å |
| Resolution | 2.05 Å |
|---|---|
| Residue indices (Uniprot), coverage | 28-489 (28-494), 0.93 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB (not modeled) |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 57-489 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Resolution | 2.15 Å |
|---|---|
| Residue indices (Uniprot), coverage | 28-489 (28-494), 0.93 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB (not modeled) |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 59-489 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 59-489 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | E |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.12 Å |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 59-490 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.13 Å |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 59-489 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.12 Å |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 59-489 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | E |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.12 Å |
| Resolution | 2.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 59-490 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Resolution | 2.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 56-491 (51-500), 0.90 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |