Danish
Uniprot ID:  Q9YFF4
  • Protein: Protogloblin ApPgb
  • Organism: Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
  • Length: 195
  • Sequence:
    • MTPSDIPGYDYGRVEKSPITDLEFDLLKKTVMLGEKDVMYLKKACDVLKDQVDEILDLWYGWVASNEHLIYYFSNPDTGEPIKEYLERVRARFGAWILDTTCRDYNREWLDYQYEVGLRHHRSKKGVTDGVRTVPHIPLRYLIAFIYPITATIKPFLAKKGGSPEDIEGMYNAWFKSVVLQVAIWSHPYTKENDW
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00007ute , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) C45G, W59L, Y60V, V63R, C102S, F145Q, I149L
Insertions None
Deletions None
Sequence identity to UniProt 0.9641
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00007ute , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) C45G, W59L, Y60V, V63R, C102S, F145Q, I149L
Insertions None
Deletions None
Sequence identity to UniProt 0.9641
auth_asym_id B
Missing residues 62TRP-67GLU
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00007ute , Chain C 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) C45G, W59L, Y60V, V63R, C102S, F145Q, I149L
Insertions None
Deletions None
Sequence identity to UniProt 0.9641
auth_asym_id C
Missing residues 62TRP-67GLU
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00007ute , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 6-195 (1-195), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) C45G, W59L, Y60V, V63R, C102S, F145Q, I149L
Insertions None
Deletions None
Sequence identity to UniProt 0.9641
auth_asym_id D
Missing residues 62TRP-67GLU
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008eum , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 6-195 (6-195), 0.97
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C45G, W59L, Y60V, V63R, C102S, F145Q, I149L
Insertions None
Deletions M1-D5
Sequence identity to UniProt 0.9632
auth_asym_id A
Missing residues 161GLY-163SER
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008eum , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 6-195 (6-195), 0.97
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C45G, W59L, Y60V, V63R, C102S, F145Q, I149L
Insertions None
Deletions M1-D5
Sequence identity to UniProt 0.9632
auth_asym_id B
Missing residues 161GLY-163SER
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00008eum , Chain C 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 6-195 (6-195), 0.97
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C45G, W59L, Y60V, V63R, C102S, F145Q, I149L
Insertions None
Deletions M1-D5
Sequence identity to UniProt 0.9632
auth_asym_id C
Missing residues 161GLY-163SER
Structural gaps Exists
label_asym_ids of heme R
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00008eum , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 6-195 (6-195), 0.97
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C45G, W59L, Y60V, V63R, C102S, F145Q, I149L
Insertions None
Deletions M1-D5
Sequence identity to UniProt 0.9632
auth_asym_id D
Missing residues 62TRP-68HIS:161GLY-163SER
Structural gaps Exists
label_asym_ids of heme X
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å