Danish

Uniprot ID: Q9YFF4

Protein: Protogloblin ApPgb
Organism:
Length: 195
Sequence:

MTPSDIPGYDYGRVEKSPITDLEFDLLKKTVMLGEKDVMYLKKACDVLKDQVDEILDLWYGWVASNEHLIYYFSNPDTGEPIKEYLERVRARFGAWILDTTCRDYNREWLDYQYEVGLRHHRSKKGVTDGVRTVPHIPLRYLIAFIYPITATIKPFLAKKGGSPEDIEGMYNAWFKSVVLQVAIWSHPYTKENDW

Number of chains: 8

PDB ID: 7ute , Chain A
Resolution	2.10 Å
Residue indices (Uniprot), coverage	6-195 (1-195), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 7ute , Chain B
Resolution	2.10 Å
Residue indices (Uniprot), coverage	6-195 (1-195), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	G
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 7ute , Chain C
Resolution	2.10 Å
Residue indices (Uniprot), coverage	6-195 (1-195), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	I
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 7ute , Chain D
Resolution	2.10 Å
Residue indices (Uniprot), coverage	6-195 (1-195), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 8eum , Chain A
Residue indices (Uniprot), coverage	6-195 (6-195), 0.97
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 8eum , Chain B
Residue indices (Uniprot), coverage	6-195 (6-195), 0.97
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	L
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.19 Å

PDB ID: 8eum , Chain C
Residue indices (Uniprot), coverage	6-195 (6-195), 0.97
Difference from Uniprot sequence	engineered mutation
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	R
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 8eum , Chain D
Residue indices (Uniprot), coverage	6-195 (6-195), 0.97
Difference from Uniprot sequence	engineered mutation
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	X
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å