- Protein: Hemoglobin subunit beta
- Organism: Spotless smooth hound (Mustelus griseus)
- Length: 137
- Sequence:
MVHWTQEERDEISKTFQGTDMKTVVTQALDRMFKVYPWTNRYFQKRTDFRSSIHAGIVVGALQDAVKHMDDVKTLFKDLSKKHADDLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQYH
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-136 (2-137), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-136 (2-137), 0.99 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-133 (2-136), 0.99 |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | G |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.14 Å |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-133 (2-136), 0.99 |
| auth_asym_id | D |
| Structural gaps | Exists |
| label_asym_ids of heme | K |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.13 Å |