Danish
Uniprot ID:  Q9YGW1
  • Protein: Hemoglobin subunit beta
  • Organism: Spotless smooth-hound (Mustelus griseus)
  • Length: 137
  • Sequence:
    • MVHWTQEERDEISKTFQGTDMKTVVTQALDRMFKVYPWTNRYFQKRTDFRSSIHAGIVVGALQDAVKHMDDVKTLFKDLSKKHADDLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001gcv , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-136 (2-137), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001gcv , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-136 (2-137), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001gcw , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-133 (2-136), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1, H137
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 44LYS-47ASP
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00001gcw , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-133 (2-136), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1, H137
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 44LYS-47ASP
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å