Danish
Uniprot ID:  Q9YGW2
  • Protein: Hemoglobin subunit alpha
  • Organism: Spotless smooth-hound (Mustelus griseus)
  • Length: 141
  • Sequence:
    • MAFTACEKQTIGKIAQVLAKSPEAYGAECLARLFVTHPGSKSYFEYKDYSAAGAKVQVHGGKVIRAVVKAAEHVDDLHSHLETLALTHGKKLLVDPQNFPMLSECIIVTLATHLTEFSPDTHCAVDKLLSAICQELSSRYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001gcv , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-140 (2-141), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001gcv , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-140 (2-141), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001gcw , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-140 (2-141), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001gcw , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-140 (2-141), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB