- Protein: Hemoglobin subunit alpha
- Organism: Spotless smooth hound (Mustelus griseus)
- Length: 141
- Sequence:
MAFTACEKQTIGKIAQVLAKSPEAYGAECLARLFVTHPGSKSYFEYKDYSAAGAKVQVHGGKVIRAVVKAAEHVDDLHSHLETLALTHGKKLLVDPQNFPMLSECIIVTLATHLTEFSPDTHCAVDKLLSAICQELSSRYR
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-140 (2-141), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-140 (2-141), 0.99 |
| auth_asym_id | C |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-140 (2-141), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 2.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-140 (2-141), 0.99 |
| auth_asym_id | C |
| label_asym_ids of heme | I |
| Available structure | PDB |