- Protein: Non-symbiotic hemoglobin class 1
- Organism: Beet (Beta vulgaris subsp. vulgaris)
- Length: 171
- Sequence:
MSFTNVNYPASDGTVIFTEEQEALVVQSWNVMKKNSAELGLKLFLKIFEIAPTAKKMFSFVRDSDVPLEQNQKLKGHAMSVFVMTCKSAAQLRKAGKVTFGESSLKHMGSVHLKYGVVDEHFEVTRFALLETIKEAVPEMWSPEMKNAWAEAFNHLVAAIKAEMQRLSTQP
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 6-161 (1-171), 1.00 |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.12 Å |
| Resolution | 2.24 Å |
|---|---|
| Residue indices (Uniprot), coverage | 7-160 (1-171), 1.00 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.19 Å |
| Resolution | 2.24 Å |
|---|---|
| Residue indices (Uniprot), coverage | 8-161 (1-171), 1.00 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | D |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.14 Å |