Danish
Uniprot ID:  V5QR23
  • Protein: Non-symbiotic hemoglobin class 1
  • Organism: Beet (Beta vulgaris subsp. vulgaris)
  • Length: 171
  • Sequence:
    • MSFTNVNYPASDGTVIFTEEQEALVVQSWNVMKKNSAELGLKLFLKIFEIAPTAKKMFSFVRDSDVPLEQNQKLKGHAMSVFVMTCKSAAQLRKAGKVTFGESSLKHMGSVHLKYGVVDEHFEVTRFALLETIKEAVPEMWSPEMKNAWAEAFNHLVAAIKAEMQRLSTQP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00007zos , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 6-161 (1-171), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 52PHE-62GLN
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007z1u , Chain A 
Resolution 2.24 Å
Residue indices (Uniprot), coverage 7-160 (1-171), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C86A
Insertions None
Deletions None
Sequence identity to UniProt 0.9942
auth_asym_id A
Missing residues 53VAL-59PRO
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.19 Å
PDB ID:  pdb_00007z1u , Chain B 
Resolution 2.24 Å
Residue indices (Uniprot), coverage 8-161 (1-171), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C86A
Insertions None
Deletions None
Sequence identity to UniProt 0.9942
auth_asym_id B
Missing residues 52PHE-59PRO:92PHE-95SER
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å