Danish
Uniprot ID:  A0A067N4E7
  • Protein: DyP-type peroxidase
  • Organism: Oyster mushroom (Pleurotus ostreatus (strain PC15))
  • Length: 504
  • Sequence:
    • MTTPAPPLDLNNIQGDILGGLPKRTETYFFFDVTNVDQFKANMAHFIPHIKTSAGIIKDREAIKEHKRQKKPGLVPMAAVNVSFSHLGLQKLGITDDLSDNAFTTGQRKDAEILGDPGSKNGDAFTPAWEAPFLKDIHGVIFVAGDCHGSVNKKLDEIKHIFGVGTSHASISEVTHVRGDVRPGDVHAHEHFGFLDGISNPAVEQFDQNPLPGQDPIRPGFILAKENGDSRAAARPDWAKDGSFLTFRYLFQMVPEFDDFLESNPIVLPGLSRKEGSELLGARIVGRWKSGAPIEITPLKDDPKLAADAQRNNKFDFGDSLVRGDQTKCPFAAHIRKTYPRNDLEGPPLKADIDNRRIIRRGIQFGPEVTSQEHHDKKTHHGRGLLFVCYSSSIDDGFHFIQESWANAPNFPVNAVTSAGPIPPLDGVVPGFDAIIGQKVGGGIRQISGTNPNDPTTNITLPDQDFVVPRGGEYFFSPSITALKTKFAIGVASPAPHSQAPISA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00006fsk , Chain A 
Resolution 1.56 Å
Residue indices (Uniprot), coverage 6-489 (6-489), 0.96
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) F194Y, N200H
Insertions None
Deletions M1-A5, G490-A504
Sequence identity to UniProt 0.9959
auth_asym_id A
Missing residues 147CYS-147CYS
Nonstandard amino acids CSO Structure of CSOCSO
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00006fsk , Chain B 
Resolution 1.56 Å
Residue indices (Uniprot), coverage 6-489 (6-489), 0.96
Difference from Uniprot sequence conflict:engineered mutation
Mutations (UniProt numbering) F194Y, N200H
Insertions None
Deletions M1-A5, G490-A504
Sequence identity to UniProt 0.9959
auth_asym_id B
Missing residues 147CYS-147CYS
Nonstandard amino acids CSO Structure of CSOCSO
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00006fsl , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 6-489 (6-489), 0.96
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F194W
Insertions None
Deletions M1-A5, G490-A504
Sequence identity to UniProt 0.9979
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006fsl , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 6-489 (6-489), 0.96
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F194W
Insertions None
Deletions M1-A5, G490-A504
Sequence identity to UniProt 0.9979
auth_asym_id B
label_asym_ids of heme D
Available structure PDB