Danish
Uniprot ID:  A0A075B5G0
  • Protein: Hemoglobin
  • Organism: Emu (Dromaius novaehollandiae)
  • Length: 146
  • Sequence:
    • VQWSAEEKQLISSLWGKVNVAECGAEALARLLIVYPWTQRFFTSFGNLSSASAIIGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDPENFRLLGDILIIVLAAHFAKEFTPECQAAWQKLVRVVAHALARKYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003wtg , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-146 (1-146), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003wtg , Chain D 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-146 (1-146), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme K
Available structure PDB