Danish
Uniprot ID:  A0A087WNH2
  • Protein: Peroxidase
  • Organism: Indian banyan tree (Ficus benghalensis)
  • Length: 306
  • Sequence:
    • QLTPTFYRSTCPNVTSIVRGVIQDALQTDLRIPASLIRLHFHDCFVNGCDGSLLLDNSDTIESEKQAAPNNNSARGFDVVDNIKTAVENACPGVVSCADILTIAAEQSVWLSGGPSWPVPLGRRDSLTANRTLANQTLPSPFLTLDQLKTDFSDQGLNTTDLVALSGAHTFGRAQCQFFSQRLYNFSATGSPDPTLNTTLLETLRNICPQGGNGSTITNLDQTTPDAFDNKYFSNLQTQYGILQTDQELFSTKGANTTAIVTKFSANQSAFFNSFVASMIKMGNIGVLTNDEGEIRSNCRSVNGGA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00004cuo , Chain A 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 1-306 (1-306), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 290ASN-291ASP
Structural gaps Exists
Nonstandard amino acids SNN Structure of SNNSNN
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004cuo , Chain A-1 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 1-306 (1-306), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 290ASN-291ASP
Structural gaps Exists
Nonstandard amino acids SNN Structure of SNNSNN
label_asym_ids of heme F-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å