Uniprot ID: A0A0A0NSZ7
- Protein: Cytochrome P450
- Organism: Streptomyces hygroscopicus (strain ATCC 29253) (Streptomyces rapamycinicus (strain ATCC 29253 / DSM 41530 / NRRL 5491 / AYB-994))
- Length: 404
- Sequence:
MSTTDQGETGKACPYPFAEMERLEIHPEYNRLRDAGELGRVLMPYGGETWLATSWEDVAKVFVDPRFSRSATLGKDVPRVLPAIQDQPVIMLMDPPEHTRLRRLATKALTSRRMEALRPRTQEVADDLIDKMLAKGAPADLMEDFALPLPIIMICELLGVPIEDQTKFRTWSDQMLSNGAYSQEVVMAAGQSLYLYLSELIAERRKQDTNDLLGSLVRARDKDDRLSETELVGFAVTLLIAGYETTANAIGNSVYTLLTHPEKLAELRKDLSLIPKAVDELLRIIPIAKQASWVRMAVEDVELSGTIVKAGEAVAIQTHSANTDPKVYDHPEEIDFHRTSNPHMSLGHGAHHCMGAQLVRVEMQTALGSLISRIPALRFAVPEPRIKFLRGRLVPSLEALPLTW
Number of chains: 4
| Resolution | 2.97 Å |
|---|---|
| Residue indices (Uniprot), coverage | 12-404 (1-404), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | None |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | A |
| Missing residues | 86ASP-86ASP:176LEU-178ASN:208ASP-209THR:219ALA-224ASP |
| Structural gaps | Exists |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of experimental residues after energy minimization | 0.17 Å |
| Resolution | 2.97 Å |
|---|---|
| Residue indices (Uniprot), coverage | 12-404 (1-404), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | None |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | B |
| Missing residues | 85GLN-86ASP:176LEU-180ALA:208ASP-211ASP:220ARG-223ASP |
| Structural gaps | Exists |
| label_asym_ids of heme | F |
| Available structure | PDB and Modeled |
| RMSD of experimental residues after energy minimization | 0.18 Å |
| Resolution | 3.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-404 (1-404), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | None |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | A |
| Missing residues | 86ASP-86ASP:177SER-180ALA |
| Structural gaps | Exists |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of experimental residues after energy minimization | 0.22 Å |
| Resolution | 3.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-404 (1-404), 1.00 |
| Mutations (UniProt numbering) | None |
| Insertions | None |
| Deletions | None |
| Sequence identity to UniProt | 1.0000 |
| auth_asym_id | B |
| Missing residues | 178ASN-179GLY |
| Structural gaps | Exists |
| label_asym_ids of heme | D |
| Available structure | PDB and Modeled |
| RMSD of experimental residues after energy minimization | 0.20 Å |