Danish
Uniprot ID:  A0A0D6E1E6
  • Protein: Cytochrome b559 subunit alpha
  • Organism: Green alga (Bryopsis plumosa)
  • Length: 82
  • Sequence:
    • MSGTTGERPFSDILTSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTEDRQQAPLITDRFNALEQVKSLSEI
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00009k7v , Chain B 
Resolution 3.07 Å
Residue indices (Uniprot), coverage 45-109 (1-82), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme CB
Available structure PDB
PDB ID:  pdb_00009k7v , Chain BA 
Resolution 3.07 Å
Residue indices (Uniprot), coverage 45-109 (1-82), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id e
label_asym_ids of heme PK
Available structure PDB