Danish
Uniprot ID:  A0A0W8ATM9
  • Protein: Peroxidase
  • Organism: Klebsiella pneumoniae
  • Length: 299
  • Sequence:
    • MSQVQSGILPEHCRAAIWIEANLKGDVNALREASKIFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGADELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAALAAFGDAIDVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKDANEEIDGDERPVTSHLSRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLERIQAL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  24
PDB ID:  pdb_00006fiy , Chain A 
Resolution 1.09 Å
Residue indices (Uniprot), coverage 2-300 (1-299), 1.00
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) D143A, R232A
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 0.9933
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006fiy , Chain B 
Resolution 1.09 Å
Residue indices (Uniprot), coverage -2-300 (1-299), 1.00
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) D143A, R232A
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 0.9933
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00006fl2 , Chain A 
Resolution 1.27 Å
Residue indices (Uniprot), coverage 2-300 (1-299), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D143A
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006fl2 , Chain B 
Resolution 1.27 Å
Residue indices (Uniprot), coverage -2-300 (1-299), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D143A
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00006rpd , Chain A 
Resolution 1.52 Å
Residue indices (Uniprot), coverage 2-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006rpd , Chain B 
Resolution 1.52 Å
Residue indices (Uniprot), coverage 3-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00006fks , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 2-299 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006fks , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 3-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006rpe , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006rpe , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 3-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00006fkt , Chain A 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 2-300 (1-299), 1.00
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) R232A
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006fkt , Chain B 
Resolution 1.86 Å
Residue indices (Uniprot), coverage 2-300 (1-299), 1.00
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) R232A
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006rqy , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 0-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006rqy , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 3-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00006rr1 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 0-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006rr1 , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 3-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00006rr4 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 0-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006rr4 , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 3-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00006rr5 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 0-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006rr5 , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 3-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00006rr6 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 0-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006rr6 , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 3-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00006rr8 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 0-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006rr8 , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 3-300 (1-299), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insPLG, 299insG
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme K
Available structure PDB