- Protein: Peroxidase
- Organism:
- Length: 299
- Sequence:
MSQVQSGILPEHCRAAIWIEANLKGDVNALREASKIFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGADELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAALAAFGDAIDVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKDANEEIDGDERPVTSHLSRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLERIQAL
| Resolution | 1.09 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-300 (1-299), 1.00 |
| Difference from Uniprot sequence | conflict:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.09 Å |
|---|---|
| Residue indices (Uniprot), coverage | -2-300 (1-299), 1.00 |
| Difference from Uniprot sequence | conflict:expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.27 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-300 (1-299), 1.00 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.27 Å |
|---|---|
| Residue indices (Uniprot), coverage | -2-300 (1-299), 1.00 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.52 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.52 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-299 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.86 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-300 (1-299), 1.00 |
| Difference from Uniprot sequence | conflict:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.86 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-300 (1-299), 1.00 |
| Difference from Uniprot sequence | conflict:expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-300 (1-299), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | K |
| Available structure | PDB |