- Protein: superoxide dismutase
- Organism: Antarctic cod (Dissostichus mawsoni)
- Length: 179
- Sequence:
MERMQGEAEGDHLERPSPLTDKERVMIQDSWAKVYENCDDTGVAILVRLFVNFPSSRQYFSQFKHIEEPEELERSAQLRKHANRVMNGLNTLVESLDNSEKVASVLKLLGKAHALRHKVEPVYFKILSGVILEVLGEAFSEVVTPEVAAAWTKLLATIYCGINAVYEEVGWSKHSSSSG
| Resolution | 3.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 17-172 (1-179), 1.00 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 3.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 17-173 (1-179), 1.00 |
| Difference from Uniprot sequence | engineered mutation |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |