Danish
Uniprot ID:  A0A192X9K5
  • Protein: superoxide dismutase
  • Organism: Antarctic cod (Dissostichus mawsoni)
  • Length: 179
  • Sequence:
    • MERMQGEAEGDHLERPSPLTDKERVMIQDSWAKVYENCDDTGVAILVRLFVNFPSSRQYFSQFKHIEEPEELERSAQLRKHANRVMNGLNTLVESLDNSEKVASVLKLLGKAHALRHKVEPVYFKILSGVILEVLGEAFSEVVTPEVAAAWTKLLATIYCGINAVYEEVGWSKHSSSSG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006q6p , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 17-172 (1-179), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C38S, C160S
Insertions None
Deletions None
Sequence identity to UniProt 0.9888
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006q6p , Chain B 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 17-173 (1-179), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) C38S, C160S
Insertions None
Deletions None
Sequence identity to UniProt 0.9888
auth_asym_id B
label_asym_ids of heme D
Available structure PDB