Danish
Uniprot ID:  A0A1D1VNB4
  • Protein: Cytochrome b5 heme-binding domain-containing protein
  • Organism: Water bear (Ramazzottius varieornatus)
  • Length: 105
  • Sequence:
    • MTSDGARMSKAEEQTFSWSEISQHTSANSLWVVVRDKTSPGSPLRVYDVTNFQKTHPGGHLILLKYAGTECSRAFAAVGHSKYAIKRMSQYRIGIAEADNVEPRK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00007bwh , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 12-99 (10-102), 0.97
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1L, T2Y, S3F, D4Q, G5S, A6L, M8K, S9D
Insertions 0insHHHHHHSSEN
Deletions P103-K105
Sequence identity to UniProt 0.9216
auth_asym_id A
label_asym_ids of heme B
Available structure PDB