Danish
Uniprot ID:  A0A1I8N8V4
  • Protein: Cytochrome c domain-containing protein
  • Organism: House fly (Musca domestica)
  • Length: 108
  • Sequence:
    • MGVPAGDVEKGKKIFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGFAYTDANKAKGITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00009msz , Chain A 
Resolution 1.10 Å
Residue indices (Uniprot), coverage -3-103 (2-108), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00009msz , Chain B 
Resolution 1.10 Å
Residue indices (Uniprot), coverage -3-103 (2-108), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00009mt0 , Chain A 
Resolution 1.20 Å
Residue indices (Uniprot), coverage -3-103 (2-108), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00009mt0 , Chain B 
Resolution 1.20 Å
Residue indices (Uniprot), coverage -3-103 (2-108), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00009mt1 , Chain A 
Resolution 1.41 Å
Residue indices (Uniprot), coverage -3-103 (2-108), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00009mt1 , Chain B 
Resolution 1.41 Å
Residue indices (Uniprot), coverage -3-103 (2-108), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB