- Protein: Cytochrome c1-2, heme protein, mitochondrial
- Organism: Mung bean (Vigna radiata var. radiata)
- Length: 306
- Sequence:
MTGGVFQLLRRKLHPQFTNSSLLSPIIAKKDGAGSTGSRSLKVLALIGAGVSGFFSFSTVAVADEAEHGLACPSYPWPHKGILSSYDHASIRRGHQVYTEVCASCHSMSLISYRDLVGVAYTEEEVKAMAAEIEVVDGPNDEGEMFTRPGKLSDRFPQPYANEAAARFANGGAYPPDLSLITKARHNGQNYVFSLLTGYRDPPAGVSIREGLHYNPYFPGGAIAMPKMLNDGAVEYEDGTPATEAQMGKDVVSFLSWAAEPEMEERKLMGFKWIFVLSLALLQAAYYRRLRWSVLKSRKLVLDVVN
| Residue indices (Uniprot), coverage | 63-306 (1-306), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | HA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 63-306 (1-306), 1.00 |
|---|---|
| auth_asym_id | P |
| label_asym_ids of heme | ZA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 63-306 (1-306), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | QA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 63-306 (1-306), 1.00 |
|---|---|
| auth_asym_id | P |
| label_asym_ids of heme | FB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 64-306 (1-306), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | YB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 64-306 (1-306), 1.00 |
|---|---|
| auth_asym_id | P |
| label_asym_ids of heme | MC |
| Available structure | PDB |