Danish
Uniprot ID:  A0A1X8XL85
  • Protein: Alpha chain
  • Organism: Persian sturgeon (Acipenser persicus)
  • Length: 142
  • Sequence:
    • TLTSADKSHVKSIWSKASGKAEELGAEALGRMLEVFPNTKTYFSHYADLSVTSGQVHTHGKKILDAITTAVNHIDDITGVLTALSTLHAKTLRVDPANFKILSHTILVVLALYFPADFTPEVHLACDKFLASVSHTLATKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006iyh , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 2-143 (1-142), 1.00
Mutations (UniProt numbering) T1S, T52S, V80T, L81M
Insertions None
Deletions None
Sequence identity to UniProt 0.9718
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006iyh , Chain A-1 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 2-143 (1-142), 1.00
Mutations (UniProt numbering) T1S, T52S, V80T, L81M
Insertions None
Deletions None
Sequence identity to UniProt 0.9718
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB