Danish
Uniprot ID:  A0A1X8XL86
  • Protein: Beta chain
  • Organism: Persian sturgeon (Acipenser persicus)
  • Length: 146
  • Sequence:
    • XEWTDSERFAIVTLWAKVNVETVGAQALVRLLVVYPWTQRYFGAFGNISDAAAIAGNAQVHAHGKTVLDSVGNAIAHMDDVADAFTALSTFHSETLHVDPDNFQHFGDCLSIVLAATFGTAYTPDVQAAWQKMIAVIISALSKEYX
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006iyh , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 2-146 (2-145), 0.99
Mutations (UniProt numbering) V12T, T22S, X146H
Insertions None
Deletions X1
Sequence identity to UniProt 0.9793
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006iyh , Chain B-1 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 2-146 (2-145), 0.99
Mutations (UniProt numbering) V12T, T22S, X146H
Insertions None
Deletions X1
Sequence identity to UniProt 0.9793
auth_asym_id B
label_asym_ids of heme D-1
Available structure PDB