Danish
Uniprot ID:  A0A1Z0YU11
  • Protein: Alpha chain
  • Organism: Starry sturgeon (Acipenser stellatus)
  • Length: 142
  • Sequence:
    • TLTSADKSHVRSIWSKAGGSAEEIGAEALGRMLESFPNTKTYFNHYADLSSSSAQVHTHGKKIIDALTTAVNHIDDITGALSSLSTLHAQTLRVDPANFKILSHTILVVLALYFPADFTPEVHLACDKFLANVSHALANNYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006iyi , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 2-143 (1-142), 1.00
Mutations (UniProt numbering) T1S, N44D, S51V, N139D
Insertions None
Deletions None
Sequence identity to UniProt 0.9718
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006iyi , Chain A-1 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 2-143 (1-142), 1.00
Mutations (UniProt numbering) T1S, N44D, S51V, N139D
Insertions None
Deletions None
Sequence identity to UniProt 0.9718
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB