Danish
Uniprot ID:  A0A1Z0YU12
  • Protein: Beta chain
  • Organism: Starry sturgeon (Acipenser stellatus)
  • Length: 146
  • Sequence:
    • VKWTDSERFAIVTLWAKVDVERVGAQALVRLLVVYPWTQRYFGAFGNISDAAAIAGNAKVHAHGKTVLSSVGIAIAHMDDLAGAFTALSTFHTETLHVDPDNFQHFGDCLSIVLAATFGTAYTPDVHAAWQKMIAVIISALSKEYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006iyi , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-146 (1-146), 1.00
Mutations (UniProt numbering) V12T, T90A, T93S, Q104E
Insertions None
Deletions None
Sequence identity to UniProt 0.9726
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006iyi , Chain B-1 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-146 (1-146), 1.00
Mutations (UniProt numbering) V12T, T90A, T93S, Q104E
Insertions None
Deletions None
Sequence identity to UniProt 0.9726
auth_asym_id B
label_asym_ids of heme D-1
Available structure PDB