Danish
Uniprot ID:  A0A2D2CY72
  • Protein: Di-heme enzyme
  • Organism: Methylosinus trichosporium (strain ATCC 35070 / NCIMB 11131 / ACM 3311 / UNIQEM 75 / OB3b)
  • Length: 380
  • Sequence:
    • MMRASFLVLAALVLGARSAAEPAPAWNWDLPKYIPPPRVPVDNPMSEEKFQLGRRLFYDKRLSGNGTLSCSSCHLQERAFTDGRTVSIGSTGAKTPRNAPSIAYSGWHGTLTWANPALVTLERQMLNPLFGADPIEMGASDANKAEIVARFRADADYRRWFAAAFPEMSEPISFATIIAAISAFQRGVYSFDSRYDHYLQGEAQLTEAEQRGHDLYFGEKAECHHCHGSVGLDDQFVHARTREPELPFHNTGLYDIDGKGAYPAPNHGLFDITGDPDDMGKFRAPSLRNIALTAPYMHDGSVATLEEVIDIYSEGGRKIASGPHAGDGRASALKSGLIVKIDLTAQEKADLLAFLKTLTDESLIASPRFSDPWRTPTAAK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006e1c , Chain A 
Resolution 2.62 Å
Residue indices (Uniprot), coverage 25-374 (1-380), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 379insKWSHPQFE
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D ,  C
Available structure PDB
PDB ID:  pdb_00006e1c , Chain B 
Resolution 2.62 Å
Residue indices (Uniprot), coverage 25-374 (1-380), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 379insKWSHPQFE
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Structural gaps Exists
label_asym_ids of heme G ,  F
Available structure PDB