Danish
Uniprot ID:  A0A2Z6I6U9
  • Protein: Class II cytochrome c
  • Organism: Shewanella sp. (strain DB6705)
  • Length: 153
  • Sequence:
    • MNKKLKMTVLALVSSAILSTAVQASNFKEADDAIHYRQSAFSLMAHNFGDMGAMLKGKKPFDSEIFAMRAQNVAALSKLPLEGFIPGSDQGETEALAKIWTEKSDFDAKMKTLQDNAAALLLASASDDKKLLKQSFMQVAKSCKGCHDVYKKD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00006a3k , Chain A 
Resolution 1.71 Å
Residue indices (Uniprot), coverage 1-129 (25-153), 0.84
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006a3k , Chain A-1 
Resolution 1.71 Å
Residue indices (Uniprot), coverage 1-129 (25-153), 0.84
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00008h28 , Chain A 
Resolution 2.06 Å
Residue indices (Uniprot), coverage 1-129 (25-153), 0.84
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K111V
Insertions None
Deletions M1-A24
Sequence identity to UniProt 0.9922
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00008h28 , Chain B 
Resolution 2.06 Å
Residue indices (Uniprot), coverage 1-129 (25-153), 0.84
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K111V
Insertions None
Deletions M1-A24
Sequence identity to UniProt 0.9922
auth_asym_id B
label_asym_ids of heme D
Available structure PDB