Danish
Uniprot ID:  A0A365PQ86
  • Protein: Cytochrome c-551
  • Organism: Stutzerimonas zhaodongensis
  • Length: 104
  • Sequence:
    • MKKVLIPLLALGGAMVLQPAVAQDGEALFKSKPCAACHSIDAKMVGPALKEVAAKYAGQEGAADLLAGHIKNGTQGNWGPIPMPPNPVTEEEAKTLAEWVLSLK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006kq1 , Chain A 
Resolution 1.57 Å
Residue indices (Uniprot), coverage 1-82 (23-104), 0.79
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006kq1 , Chain B 
Resolution 1.57 Å
Residue indices (Uniprot), coverage 1-82 (23-104), 0.79
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A22
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I
Available structure PDB