Danish
Uniprot ID:  A0A3B6UES8
  • Protein: Cytochrome c
  • Organism: Pichia membranifaciens
  • Length: 109
  • Sequence:
    • MAPFEKGSAKKGATLEKTRCLQCHTVEKGGPHKVGPNLHGIFARHSGQAEGYSYTDANIKANVEWTPNNMSEYLENPKKYIPGTKMAFGGLKKEKDRNDLVTYMKKATK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00006c4w , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage -6-103 (1-109), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 72LYS-72LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å