Danish
Uniprot ID:  A0A3N1PKS7
  • Protein: Cytochrome P450
  • Organism: Gallaecimonas pentaromativorans
  • Length: 384
  • Sequence:
    • MKFEPSDALFKDPYHFLDLGLDAGSDIIEFPEQNYYLTDLDDAKAVLANKDENYHPHSDFFFTSRGLLQPRSRQVDMARGAVKFLQQHLNATRRLLPERVKEQLQGRHSWPDISNLFMFSLFEPALLDARGDKTLKNCLDEIVHRSVLSGKRLEHGGWRRWLYRQRNYRLLKKEIRARRRGLVECQDVMSALVGAADHGISDTELADIFLSFLFATTGSLGFCLSWCLHLVSEAPEKAKLPSQWLVLEALRLWPVAWNLARMPAKDHQLPSGHKVSNNSVVIACPYSVQRNPKHWPDADRFLPERWQDNSNRQRLLAFGWGEHKCVASNLTLELVSELLDIILGNYHLSCEYSGERPLAQAALAPPSFTLTLSAKTEHNHAQLA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00009ulw , Chain A 
Resolution 2.62 Å
Residue indices (Uniprot), coverage 1-376 (1-376), 0.98
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F62G
Insertions None
Deletions E377-A384
Sequence identity to UniProt 0.9973
auth_asym_id A
Missing residues 63THR-65ARG:153LEU-155HIS
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00009ulw , Chain B 
Resolution 2.62 Å
Residue indices (Uniprot), coverage 1-376 (1-376), 0.98
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F62G
Insertions None
Deletions E377-A384
Sequence identity to UniProt 0.9973
auth_asym_id B
Missing residues 62GLY-67LEU:154GLU-156GLY:182LEU-184GLU
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 1.18 Å