Danish
Uniprot ID:  A0A4X1UNI7
  • Protein: Cytochrome c1, heme protein, mitochondrial
  • Organism: Pig (Sus scrofa)
  • Length: 326
  • Sequence:
    • MSAAAAASLRGAVLGPRGAGLPGARARGLLCGPRPGQLPLRTPQALSLSSKSGLSRGRKVILSALGMLAAGGAGLAVALHSAVSATDLELHAPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWASEPEHDHRKRMGLKMLMMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  10
PDB ID:  pdb_00008uge , Chain D 
Residue indices (Uniprot), coverage 92-329 (1-325), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions K326
Sequence identity to UniProt 1.0000
auth_asym_id 3D
label_asym_ids of heme GA
Available structure PDB
PDB ID:  pdb_00008uge , Chain N 
Residue indices (Uniprot), coverage 2-240 (1-325), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions K326
Sequence identity to UniProt 1.0000
auth_asym_id 3Q
label_asym_ids of heme VA
Available structure PDB
PDB ID:  pdb_00008ugf , Chain D 
Residue indices (Uniprot), coverage 92-329 (1-325), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions K326
Sequence identity to UniProt 1.0000
auth_asym_id 3D
label_asym_ids of heme GA
Available structure PDB
PDB ID:  pdb_00008ugf , Chain N 
Residue indices (Uniprot), coverage 2-240 (1-325), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions K326
Sequence identity to UniProt 1.0000
auth_asym_id 3Q
label_asym_ids of heme UA
Available structure PDB
PDB ID:  pdb_00008ugg , Chain D 
Residue indices (Uniprot), coverage 92-329 (1-325), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions K326
Sequence identity to UniProt 1.0000
auth_asym_id 3D
label_asym_ids of heme FA
Available structure PDB
PDB ID:  pdb_00008ugg , Chain N 
Residue indices (Uniprot), coverage 2-240 (1-325), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions K326
Sequence identity to UniProt 1.0000
auth_asym_id 3Q
label_asym_ids of heme VA
Available structure PDB
PDB ID:  pdb_00008ugk , Chain D 
Residue indices (Uniprot), coverage 92-329 (1-325), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions K326
Sequence identity to UniProt 1.0000
auth_asym_id 3D
label_asym_ids of heme DA
Available structure PDB
PDB ID:  pdb_00008ugk , Chain N 
Residue indices (Uniprot), coverage 2-240 (1-325), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions K326
Sequence identity to UniProt 1.0000
auth_asym_id 3Q
label_asym_ids of heme RA
Available structure PDB
PDB ID:  pdb_00008zsn , Chain JB 
Residue indices (Uniprot), coverage 87-325 (86-326), 0.74
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A85
Sequence identity to UniProt 1.0000
auth_asym_id Qd
label_asym_ids of heme DF
Available structure PDB
PDB ID:  pdb_00008zsn , Chain YA 
Residue indices (Uniprot), coverage 86-326 (86-326), 0.74
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A85
Sequence identity to UniProt 1.0000
auth_asym_id QD
label_asym_ids of heme ME
Available structure PDB