Danish
Uniprot ID:  A0A6L7H965
  • Protein: Protozoan/cyanobacterial globin family protein
  • Organism: anthrax bacterium (Bacillus anthracis)
  • Length: 132
  • Sequence:
    • MSKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00005v3t , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 3-132 (1-132), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005v3t , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 5-127 (1-132), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00005v3v , Chain A 
Resolution 2.14 Å
Residue indices (Uniprot), coverage 3-132 (1-132), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y26A
Insertions None
Deletions None
Sequence identity to UniProt 0.9924
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005v3v , Chain B 
Resolution 2.14 Å
Residue indices (Uniprot), coverage 5-127 (1-132), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y26A
Insertions None
Deletions None
Sequence identity to UniProt 0.9924
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00005v3u , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 2-132 (1-132), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) W90L
Insertions None
Deletions None
Sequence identity to UniProt 0.9924
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005v3u , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 5-127 (1-132), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) W90L
Insertions None
Deletions None
Sequence identity to UniProt 0.9924
auth_asym_id B
label_asym_ids of heme G
Available structure PDB