Danish
Uniprot ID:  A0A6L8PY92
  • Protein: Iron Transport-associated domain protein
  • Organism: anthrax bacterium (Bacillus anthracis)
  • Length: 152
  • Sequence:
    • MFKQFKMIIAVFAVLFTFIATLGLQDAKAATKLADGKYNIAFTVWKGDKDESSRMNRYFESPATLTVKNGKQYVSFKVKDSTSIKSFQVEKDGQFVETTVLSENKKDNTRVVEFEVADLSKKLNGKVKINIPIINYNASYDIRFVFDGNSIK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003sik , Chain A 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 30-152 (27-152), 0.87
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) T21G, L22S, G23H, L24M, Q25A, D26S
Insertions None
Deletions M1-A20
Sequence identity to UniProt 0.9545
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003sik , Chain B 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 31-152 (27-152), 0.87
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) T21G, L22S, G23H, L24M, Q25A, D26S
Insertions None
Deletions M1-A20
Sequence identity to UniProt 0.9545
auth_asym_id B
label_asym_ids of heme D
Available structure PDB