Danish
Uniprot ID:  A0A8J0PCM1
  • Protein: Cytochrome c552
  • Organism: Thioalkalivibrio paradoxus ARh 1
  • Length: 153
  • Sequence:
    • MDIGINSDPHPPHHHDHHGHGSGWEVPEAEIHRENPIPPDARSLDQGGVLYAEHCVRCHGETLRGDGPDAHDLDPPVADLVEHAPHHSDGDLAYRVRIGRGPMPGFGDALDERDIWDLVNFMRDRAQGAALAGTNGHSPDHAAGDHHHGDHHH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00007o9u , Chain A 
Residue indices (Uniprot), coverage 1-153 (1-153), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00009vr0 , Chain A 
Residue indices (Uniprot), coverage 21-136 (21-136), 0.82
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) H146L, H147E, G149H, D150H
Insertions None
Deletions D2-H20, H137-D145
Sequence identity to UniProt 0.9680
auth_asym_id A
label_asym_ids of heme B
Available structure PDB