Danish
Uniprot ID:  A0A9P2WQ76
  • Protein: Globin
  • Organism: Thermobifida fusca TM51
  • Length: 188
  • Sequence:
    • MVRVPRERSGTRSALGEASTYPVGAMTSQHDDQMTFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPEDAQPPMVQRSFTVTSNERDRGDEGETIRISLR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00004uzv , Chain A 
Resolution 3.40 Å
Residue indices (Uniprot), coverage 31-159 (1-164), 0.87
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y54F, Y67F, R91E, F107E, W119F
Insertions None
Deletions R165-R188
Sequence identity to UniProt 0.9695
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004uzv , Chain A-1 
Resolution 3.40 Å
Residue indices (Uniprot), coverage 31-159 (1-164), 0.87
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y54F, Y67F, R91E, F107E, W119F
Insertions None
Deletions R165-R188
Sequence identity to UniProt 0.9695
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB