Danish
Uniprot ID:  A0A9Y2YAH0
  • Protein: cytochrome P450 CYP101D5
  • Organism: Sphingomonas echinoides
  • Length: 409
  • Sequence:
    • MSAAEEIHTPRPAHVPADRVVELDMYNPQGIEKGYLEAWTSLQTADLPSMVWTPLNGGHWIATRGELIQDIYCDPDHFSSHVIFIPKAAGEKYAMVPSKMDPPEHRPYREVVDKGLNLRAIREREPAVRAHAIALIEAFADKGHCDFVEEFSGEFPIRVFMMMADLPMEDSPKLRAFAAGMTRPEGNTPTEMADALDRANRSFFDYVSPIIDARMGGDGTDILTLSINSQVNGAPMEREKLLGMVSLLLLAGLDTVTNFLNMTMDYLGRHPDKVRELTENPTEIRRGVEELFRRFPLVAAARMVAHDVERDGVELKQGEMVLLPTALHGLDPRVNADPWEVDFQRKRPAHSTFGNGPHRCAGLHLARLETTVMLEEWLKRIPTFRVVPGTGPTYHSGVVASVDGVRLEW
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00008gtl , Chain A 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 9-409 (1-409), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 186GLY-187ASN:219GLY-220THR
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008gtl , Chain B 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 9-409 (1-409), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 44THR-45ALA:89ALA-90GLY:217GLY-219GLY
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å