Danish
Uniprot ID:  A1YZP4
  • Protein: Alpha-chain hemoglobin
  • Organism: Brycon cephalus
  • Length: 143
  • Sequence:
    • MSLSDKDKDAIKAFWAKISPKAEDIGADALARTLTVYPQTKTYFSHWKDLSPGSAPVKKHGKTVMSGVAEAVSKIDDLTNGLLTLSELHAFQLRVDPANFKILSHNLLVVLAIQFPNDFTPEVHVSMDKFLSALALALSEKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003bcq , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-142 (2-143), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) A10S, T33M, S66G, G67S, I113Q, A133L, A135S, L136W, A137S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9366
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003bcq , Chain C 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 1-142 (2-143), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) A10S, T33M, S66G, G67S, I113Q, A133L, A135S, L136W, A137S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9366
auth_asym_id C
label_asym_ids of heme I
Available structure PDB