Danish
Uniprot ID:  A2I2W2
  • Protein: HmuY
  • Organism: Bacteroides gingivalis (Porphyromonas gingivalis)
  • Length: 216
  • Sequence:
    • MKKIIFSALCALPLIVSLTSCGKKKDEPNQPSTPEAVTKTVTIDASKYETWQYFSFSKGEVVNVTDYKNDLNWDMALHRYDVRLNCGESGKGKGGAVFSGKTEMDQATTVPTDGYTVDVLGRITVKYEMGPDGHQMEYEEQGFSEVITGKKNAQGFASGGWLEFSHGPAGPTYKLSKRVFFVRGADGNIAKVQFTDYQDAELKKGVITFTYTYPVK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003h8t , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 35-216 (26-216), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K25
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003h8t , Chain A-1 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 35-216 (26-216), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K25
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00003h8t , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 35-216 (26-216), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K25
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003h8t , Chain B-1 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 35-216 (26-216), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K25
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I-1
Available structure PDB