Danish
Uniprot ID:  A7NJ91
  • Protein: Cytochrome c domain-containing protein
  • Organism: Roseiflexus castenholzii (strain DSM 13941 / HLO8)
  • Length: 193
  • Sequence:
    • MLNLRQRRRPGSLIGRIVRAGWLMAVVLLMTACHLEMYDQAKYKPQQASEIFADGASARPLVEHTVARGRLRIDATSTGRVDGDPNGAYVTTIPIRITPELLERGAQRYRIYCAVCHGVNGNGRGQVGLLLNPRPPSFYDQRLLDMPDGEYYDVLVNGRRTMYPYGYRVQSISDRWAIVAHIRELQKNPPPQN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006lod , Chain E 
Residue indices (Uniprot), coverage 33-189 (33-193), 0.84
Difference from Uniprot sequence acetylation
Mutations (UniProt numbering) A32X
Insertions None
Deletions M1-T31
Sequence identity to UniProt 0.9938
auth_asym_id E
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00006loe , Chain E 
Residue indices (Uniprot), coverage 33-189 (33-193), 0.84
Difference from Uniprot sequence acetylation
Mutations (UniProt numbering) A32X
Insertions None
Deletions M1-T31
Sequence identity to UniProt 0.9938
auth_asym_id E
label_asym_ids of heme Q
Available structure PDB