Danish
Uniprot ID:  A8JAR4
  • Protein: Uncharacterized protein
  • Organism: Chlamydomonas smithii (Chlamydomonas reinhardtii)
  • Length: 136
  • Sequence:
    • MAADTAPADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGEAGAAN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00006cii , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 6-129 (2-136), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004xdi , Chain A 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 5-131 (2-136), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004xdi , Chain B 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 6-128 (2-136), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB