Danish
Uniprot ID:  A9DSJ8
  • Protein: 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
  • Organism: Kordia algicida OT-1
  • Length: 179
  • Sequence:
    • MKGIIFTEFLDLVEDKFGLEMVDKIITQSELESEGVYTSIGTYRFSEMLQLLQNLSANTDVSIDDLLLTYAEHFFSVIEDSYPGLLATYKDPIEMLASIENHIHVEVRKIYPDAELPTFVVEEKTANSLTMIYKSSRAMHHFGLGLMNKTFEHFNSSAEIILEKIKEDGTEVKFIINKN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006bde , Chain A 
Resolution 1.64 Å
Residue indices (Uniprot), coverage 1-185 (1-179), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) A71G
Insertions 179insENLYFQ
Deletions None
Sequence identity to UniProt 0.9944
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00006bdd , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-185 (1-179), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 179insENLYFQ
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB